PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10027693m
Common NameCARUB_v10027693mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 315aa    MW: 35021.7 Da    PI: 10.0304
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10027693mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.21.9e-081258347
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqky 47
                     +W+++Ed  + +a + +  +   +W+ Ia  ++ g+t +q++++++ +
  Carubv10027693m 12 SWSKDEDIVFERALAIYADEteiRWEEIALVVP-GKTIEQIIEHYNVL 58
                     7*****************99*************.***********976 PP

2Myb_DNA-binding38.42.8e-12102146347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT +E+ +++ + +++G+g+W++I+r+  ++Rt  q+ s+ qky
  Carubv10027693m 102 PWTSDEHRQFLLGLEKFGKGDWRSISRHCVLTRTTMQVASHAQKY 146
                      7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512937.299862IPR017884SANT domain
SMARTSM007174.2E-8961IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-41160IPR009057Homeodomain-like
SuperFamilySSF466891.87E-101268IPR009057Homeodomain-like
CDDcd001673.15E-91259No hitNo description
PfamPF002495.5E-71258IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.1E-1093149IPR009057Homeodomain-like
PROSITE profilePS5129415.15295151IPR017930Myb domain
SuperFamilySSF466895.87E-1696151IPR009057Homeodomain-like
TIGRFAMsTIGR015574.5E-1598149IPR006447Myb domain, plants
SMARTSM007171.6E-899149IPR001005SANT/Myb domain
CDDcd001674.24E-9102146No hitNo description
PfamPF002492.9E-9102146IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MNLGENASVV SSWSKDEDIV FERALAIYAD ETEIRWEEIA LVVPGKTIEQ IIEHYNVLVR  60
DVMMIESGHV PLPACYELSE EPNHRKKHGK SKAKQQRKKG IPWTSDEHRQ FLLGLEKFGK  120
GDWRSISRHC VLTRTTMQVA SHAQKYYKRL NSKNKHRNRK SIHDVTLAED KYISPKQRAI  180
TWQKFASTSN NQPIPTASQP ALGLPIHGQP NIWSTQATQA ISQPPALNHP TYGVPTTIWN  240
AAALQPSSNI HVYGTSTISQ PMVGTMLSPF GRNVNLLAQP HMNSGVHSVP SNSGPSAPIN  300
MGSIPYGTNP KDRS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A7e-14131011190RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006281581.10.0hypothetical protein CARUB_v10027693mg
TrEMBLR0GCU10.0R0GCU1_9BRAS; Uncharacterized protein
STRINGAl_scaffold_0006_22421e-137(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM133911628
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23650.11e-137Homeodomain-like transcriptional regulator